This protein is a dimeric enzyme that is expressed on the exterior face of the plasma membrane (1, 2). CD73 acts by hydrolysing nucleotide monophosphates, thereby releasing inorganic phosphate and the corresponding nucleoside. Exhibits AMP-, NAD-, and NMNnucleosidase activities (3). CD73, originally defined as a lymphocyte differentiation antigen, is thought to function as a co-signalling molecule on T lymphocytes and as an adhesion molecule that is important for lymphocyte binding to endothelium (4). CD73 is involved in the control of a variety of physiological responses including epithelial ion and fluid transport, ischemic preconditioning, tissue injury, platelet function, hypoxia and vascular leak (5). CD 73 is a potential target in immuno-oncology (6, 7).
Product is shipped either on dry or wet ice or frozen gel packs. Upon receipt, store at -20°C
to -70°C.
Antibodies | |
Amino Acids | 27-549 |
Application Note | For research purposes only. Not for use in humans. |
Endotoxins | Less than 0.1 ng/µg (1 IEU/µg), as measured by LAL method. |
Formulations | PBS 20% Glycerol |
Grade & Purity | >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon) |
Molecular Weight | 58.8 kDa |
Protein ID | P21589 |
Sequence | WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALR YDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLV FEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKV PVVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFREC NMGNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHR YGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQD INVVSTYISKMKVIYPAVEGRIKFSHHHHHH |
Source | HEK293 |
Storage | The protein should be stored at -20°C to -70°C preferably in small aliquots to avoid repeated freeze-thaw cycles |
- Stock: In Stock
- Model: DP005