Menu
Your Cart

Recombinant Human Fibroblast Growth Factor Receptor 4, FGFR4

Recombinant Human Fibroblast Growth Factor Receptor 4, FGFR4
Recombinant Human Fibroblast Growth Factor Receptor 4, FGFR4

It is a single-pass transmembrane protein composed of three extracellular Ig-like domains, a transmembrane region, and a tyrosine kinase domain (1, 2). Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and migration, and in regulation of lipid metabolism, bile acid biosynthesis, glucose uptake, vitamin D metabolism and phosphate homeostasis (3, 4, 5, 6). Required for normal down-regulation of the expression of CYP7A1, the rate-limiting enzyme in bile acid synthesis, in response to FGF19. Phosphorylates PLCG1 and FRS2. Ligand binding leads to the activation of several signalling cascades (6). Activation of PLCG1 leads to the production of the cellular signalling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signalling pathway, as well as of the AKT1 signalling pathway (7, 8, 9). Promotes SRC-dependent phosphorylation of the matrix protease MMP14 and its lysosomal degradation (10). FGFR4 signalling is down-regulated by receptor internalization and degradation; MMP14 promotes internalization and degradation of FGFR4. Mutations that lead to constitutive kinase activation or impair normal FGFR4 inactivation lead to aberrant signalling.

Product is shipped either on dry or wet ice. Upon receipt, store at -20°C to -70°C.

Antibodies
Amino Acids 22-369
Application Note For research purposes only. Not for use in humans.
Endotoxins Less than 0.1 ng/µg (1 IEU/µg), as measured by LAL method
Formulations PBS 20% Glycerol
Grade & Purity >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon)
Molecular Weight 40.1 kDa
Sequence LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLAR GSMIVLQNLTLITGDSLTSSNDDEDPKSHRDLSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKD GQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELL CKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPE EDPTWTAAAPEARYTDGSGHHHHHHHHHH
Source HEK293
Species Human
Storage The protein should be stored at -20°C to -70°C preferably in small aliquots to avoid repeated freeze-thaw cycles.
  • Stock: In Stock
  • Model: DP012
£112.00

Available Options