It is a single-pass transmembrane protein composed of three extracellular Ig-like domains,
a transmembrane region, and a tyrosine kinase domain (1, 2). Tyrosine-protein kinase that
acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the
regulation of embryonic development, cell proliferation, differentiation and migration (3, 4,
5). Required for normal mesoderm patterning and correct axial organization during
embryonic development, normal skeletogenesis and normal development of the
gonadotropin-releasing hormone (GnRH) neuronal system (6). Phosphorylates PLCG1,
FRS2, GAB1 and SHB (6). Ligand binding leads to the activation of several signalling
cascades. Activation of PLCG1 leads to the production of the cellular signalling molecules
diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers
recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS,
MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signalling pathway, as well as of the AKT1
signalling pathway (7, 8, 9). Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2
(10). In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the
regulation of transcription (11).
FGFR1c is an alternatively spliced isoform representing mesenchymal variant of FGFR1
Antibodies | |
Amino Acids | 22-376 |
Application Note | For research purposes only. Not for use in humans. |
Endotoxins | Less than 0.1 ng/µg (1 IEU/µg), as measured by LAL method. |
Formulations | PBS 20% Glycerol |
Grade & Purity | >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon) |
Molecular Weight | 40.8 kDa |
Protein ID | P11362-19 |
Sequence | RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTS SPSGSDTTYFSVNVSVPIDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNP TLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVAL GSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKHSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSA WLTVTRPALEERPAVMTSPLYLEGSGHHHHHHHHHH |
Source | HEK293 |
Species | Human |
Stability | At least 12 months at -20°C to -70°C and at least 1 month at 2°C to 8°C |
Storage | The protein should be stored at -20°C to -70°C preferably in small aliquots to avoid repeated freeze-thaw cycles |
- Stock: In Stock
- Model: DP007