Menu
Your Cart

Recombinant Human Fibroblast Growth Factor Receptor 1, FGFR1b

Recombinant Human Fibroblast Growth Factor Receptor 1, FGFR1b
Recombinant Human Fibroblast Growth Factor Receptor 1, FGFR1b

It is a single-pass transmembrane protein composed of three extracellular Ig-like domains, a transmembrane region, and a tyrosine kinase domain (1, 2). Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration (3, 4, 5). Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (6). Phosphorylates PLCG1, FRS2, GAB1 and SHB (6). Ligand binding leads to the activation of several signalling cascades. Activation of PLCG1 leads to the production of the cellular signalling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signalling pathway, as well as of the AKT1 signalling pathway (7, 8, 9). Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2 (10). In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription (11).

Product is shipped either on dry or wet ice. Upon receipt, store at -20°C to -70°C

Antibodies
Amino Acids 22-376
Application Note For research purposes only. Not for use in humans.
Endotoxins Less than 0.1 ng/µg (1 IEU/µg), as measured by LAL method.
Formulations PBS 20% Glycerol
Grade & Purity >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon)
Molecular Weight 40.8 kDa
Protein ID P11362-19
Sequence RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTS SPSGSDTTYFSVNVSVPIDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNP TLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVAL GSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKHSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSA WLTVTRPALEERPAVMTSPLYLEGSGHHHHHHHHHH
Source HEK293
Species Human
Stability At least 12 months at -20°C to -70°C and at least 1 month at 2°C to 8°C.
Storage The protein should be stored at -20°C to -70°C preferably in small aliquots to avoid repeated freeze-thaw cycles
  • Stock: In Stock
  • Model: DP006
£112.00

Available Options